PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071328.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 973aa    MW: 107925 Da    PI: 7.2156
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071328.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.37e-41134211178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C+adls+ak+yhrrhkvCevhska+ +lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  XP_011071328.1 134 VCQVDDCKADLSSAKDYHRRHKVCEVHSKATRALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTHP 211
                     6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.3E-33128196IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.325132209IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.59E-38133213IPR004333Transcription factor, SBP-box
PfamPF031101.5E-29135208IPR004333Transcription factor, SBP-box
SuperFamilySSF484036.63E-9746867IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.209.1E-8759868IPR020683Ankyrin repeat-containing domain
CDDcd002046.49E-7759867No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 973 aa     Download sequence    Send to blast
MKVVGKKSME WDLNDWRWDG DLFMASPVNS VPSDCRSRQF LPVGSDIPVK TGASSSFPSG  60
TDEVMLGDER VKRDLEKRRR SVEANEPLND EAGSLNLKLG GHVFPVMERE VVDKWEDKSG  120
KKTKVSSTSS TRAVCQVDDC KADLSSAKDY HRRHKVCEVH SKATRALVGN VMQRFCQQCS  180
RFHVLQEFDE GKRSCRRRLA GHNKRRRKTH PENVVSATNL NDEQGSNYLL ISLLRILSNL  240
HTSSSDQTKD QDLLCHLLRN LAGSSNEKNT AGLLPVSQDL QNVVASLGTA LKDTTMPAGL  300
GVTTPSPNLT LKNTVPDNAQ AGVAHNVSAS QQSALLFPEN ASNLSKANAS DTTVGRMKLN  360
NIDLNNVYDG SQDCIEDQQD NVTPENLGNV SAAVPFWLCK DLQQSSPPHN SGNSGSTQSH  420
SPSTSSGEAQ SRTDRIVFKL FGKDPSDFPL ALRKQILDWL SSSPTDIESY IRPGCVVLTI  480
YLCMDKSTWD ELYCNLNSTL GRLLESSAES FWRTGWIYTR VQHRATFVYN GEVVLDAPLP  540
LNIHRNCRIS SIKPIAVAFS ESVHFVVKGF NLSRATSRLL CALEGKYLVQ ENCADMTGAA  600
DSFVQHQEIQ CLGFSCFIPN IIGRGFIEVE DHSLSSSFFP FIVAEKDVCS EICSLESIID  660
GADTVYENAD EVRARDQALD FVHEMGWLLH KNRLIFRLGA SNGNMDPFSF KRFRWLIEFA  720
IDHDWCAVVK KLLNILLDGT VDSGQYTSTL VALLEIGLLH RAVRRNSRSM VEFLLEYHPS  780
GALDNRGPEE KQLDEGQYLF KPDSMGPGGL TPLHVAASLD SSENVLDALT ADPGSVGIEA  840
WKKARDSMGL TPHDYACLRG HYSYVHLVQR KLKKKSGDGQ VVVDIPGMLL DGNNVKQKIG  900
NTSKSRKLGV FQTEXKLSYG RWRASVTIYR PAMVSMVAIA AVCVCAALLF KSSPEVLYSF  960
RPFRWELLKY GSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-32126208284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203209KRRRKTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071328.10.0PREDICTED: LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 1
TrEMBLA0A075FET00.0A0A075FET0_SALMI; SQUAM
STRINGSolyc05g053240.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1